Collection: uoqowuerwehgflasfhdgfkasjyuwerwyeqrthgasdhkfcashwe-qwerqwedfjjlhh
-
...
Non-Contact Thermometer for Adults and Kids, Fast Accurate Thermometer with Fever Alarm, 1S Reading & Silent Mode (LCD-Black)
Vendor:AmazonRegular price $15.99Regular priceUnit price / perSale price $15.99 -
...
Bedsure White King Size Comforter Set - Bedding Set King 7 Pieces, Pintuck Bed in a Bag White Bed Set with Comforter, Sheets, Pillowcases & Shams
Vendor:AmazonRegular price $55.24Regular priceUnit price / perSale price $55.24 -
...
EMEET C960 4K Webcam for PC, 4K UHD Sony Sensor, TOF Auto Focus, Dual AI Noise-Cancelling Mics, Auto Light Correction, 66° FOV, Plug&Play Webcam with Privacy Cover, Works with Zoom/Teams/Skype/Google
Vendor:AmazonRegular price $47.99Regular priceUnit price / perSale price $47.99 -
...
Marc Jacobs Flash Leather Camera Crossbody Bag
Vendor:Nordstrom RackRegular price $179.97Regular priceUnit price / perSale price $179.97 -
...
Marc Jacobs Flash Leather Camera Crossbody Bag
Vendor:Nordstrom RackRegular price $179.00Regular priceUnit price / perSale price $179.00 -
...
JoyJolt JoyFul 24pc Borosilicate Glass Storage Containers with Lids. 12 Airtight, Freezer Safe Food Storage Containers, Pantry Kitchen Storage Containers, Glass Meal Prep Container for Lunch
Vendor:AmazonRegular price $38.95Regular priceUnit price / perSale price $38.95 -
...
Beats Fit Pro - True Wireless Noise Cancelling Earbuds - Apple H1 Headphone Chip, Compatible with Apple & Android, Class 1 Bluetooth, Built-in Microphone, 6 Hours of Listening Time - Tidal Blue
Vendor:AmazonRegular price $159.99Regular priceUnit price / perSale price $159.99 -
...
Bedroom Table Lamps Set of 2 - Touch Bedside Lamps with USB C+A, 3 Way Dimmable Gold Lamp for Nightstand, Modern Night Stands Lamps for Living Room End Tables Desk Bed Side Study Room(19.6in)
Vendor:AmazonRegular price $49.99Regular priceUnit price / perSale price $49.99 -
...
Cetaphil Healthy Renew Hydrating Eye Gel Serum 0.5 Oz, 24Hr Under Eye Cream for Anti Aging, Reduces the Appearance of Dark Circles and Wrinkles, Retinol Alternative Peptide Serum, For Sensitive Skin
Vendor:AmazonRegular price $15.92Regular priceUnit price / perSale price $15.92 -
...
Cetaphil Face Wash, Daily Facial Cleanser for Sensitive, Combination to Oily Skin, NEW 16 oz, Fragrance Free,Gentle Foaming, Soap Free, Hypoallergenic
Vendor:AmazonRegular price $9.58Regular priceUnit price / perSale price $9.58 -
...
Aquasonic Black Series Ultra Whitening Toothbrush – ADA Accepted Power Toothbrush - 8 Brush Heads & Travel Case – 40,000 VPM Electric Motor & Wireless Charging - 4 Modes w Smart Timer
Vendor:AmazonRegular price $29.95Regular priceUnit price / perSale price $29.95 -
...
FERRAGAMO Round Mesh Strap Watch, 34mm
Vendor:Nordstrom RackRegular price $519.97Regular priceUnit price / perSale price $519.97 -
...
Tovolo Glide-A-Scoop Ice Cream Tub, 1.5 Quart, Insulated, Airtight Reusable Container With Non-Slip Base, Stackable on Freezer Shelves, BPA-Free, Orange Crush
Vendor:AmazonRegular price $13.68Regular priceUnit price / perSale price $13.68 -
...
roborock Q5 Robot Vacuum Cleaner, Strong 2700Pa Suction, Upgraded from S4 Max, LiDAR Navigation, Multi-Level Mapping, 180 mins Runtime, No-go Zones, Ideal for Carpets and Pet Hair
Vendor:AmazonRegular price $259.98Regular priceUnit price / perSale price $259.98 -
...
O-Cedar EasyWring Microfiber Spin Mop, Bucket Floor Cleaning System, Red, Gray
Vendor:AmazonRegular price $29.99Regular priceUnit price / perSale price $29.99 -
...
Amazon Basics Round Cylindrical Soft-Close Small Trash Can With Foot Pedal, 5 Liter/1.3 Gallon, Brushed Stainless Steel
Vendor:AmazonRegular price $19.49Regular priceUnit price / perSale price $19.49















