Collection: uoqowuerwehgflasfhdgfkasjyuwerwyeqrthgasdhkfcashwe-qwerqwedfjjlhh
-
...
IRIS USA 3-Speed High-Power Professional-grade Countertop & Kitchen Blender - 50 oz Tritan Jar, Titanium-Coated Stainless Steel -Blades, Charcoal Black -for Smoothies, Frozen Drinks, Protein Shakes
Vendor:AmazonRegular price $39.99Regular priceUnit price / perSale price $39.99 -
...
IRIS USA 19 Quart Stack & Pull™ Box, Clear with Black Handles, Set of 6
Vendor:AmazonRegular price $32.99Regular priceUnit price / perSale price $32.99 -
...
Moissanite Stud Earrings Lab Created Diamond 18K White Gold Plated 925 Sterling Silver Earring Jewelry Gifts for Women Men
Vendor:AmazonRegular price $19.99Regular priceUnit price / perSale price $19.99 -
...
Playskool Step Start Walk 'n Ride Active 2-in-1 Ride-On and Walker Toy for Toddlers and Babies 9 Months and Up (Amazon Exclusive)
Vendor:AmazonRegular price $19.99Regular priceUnit price / perSale price $19.99 -
...
Sperax Treadmill-Walking Pad-Under Desk Treadmill-2 in 1 Folding Treadmill-Treadmills for Home-Black Red
Vendor:AmazonRegular price $299.00Regular priceUnit price / perSale price $299.00 -
...
Braun Series 7 7020s Flex Electric Razor for Men with Precision Trimmer, Wet & Dry, Rechargeable, Cordless Foil Shaver, Silver
Vendor:AmazonRegular price $99.94Regular priceUnit price / perSale price $99.94 -
...
Koolaburra by UGG mens Kolson
Vendor:AmazonRegular price $49.99Regular priceUnit price / perSale price $49.99 -
...
Koolaburra by UGG womens Koola Short
Vendor:AmazonRegular price $64.99Regular priceUnit price / perSale price $64.99 -
...
CINCOM Hand Massager(FSA or HSA Eligible)- Cordless Hand Massager with Heat and Compression for Arthritis and Carpal Tunnel - Gifts for Women(White)
Vendor:AmazonRegular price $55.28Regular priceUnit price / perSale price $55.28 -
...
MEGA BLOKS Fisher-Price Toddler Block Toys, Big Building Bag With 80 Pieces and Storage Bag, Red, Gift Ideas For Kids Age 1+ Years
Vendor:AmazonRegular price $13.99Regular priceUnit price / perSale price $13.99 -
...
KitchenAid Artisan Series 5 Quart Tilt Head Stand Mixer with Pouring Shield KSM150PS, Almond Cream
Vendor:AmazonRegular price $349.99Regular priceUnit price / perSale price $349.99 -
...
Amazon Basics Slim, Velvet, Non-Slip Suit Clothes Hangers, Black/Silver - Pack of 50
Vendor:AmazonRegular price $23.21Regular priceUnit price / perSale price $23.21 -
...
CATAN Board Game 5-6 Player EXTENSION - Expand Your CATAN Game for More Players, Strategy Game for Kids and Adults, Ages 10+, 3-6 Players, 60-90 Minute Playtime, Made by CATAN Studio
Vendor:AmazonRegular price $17.49Regular priceUnit price / perSale price $17.49 -
...
Ticket to Ride First Journey Board Game | Strategy Game | Train Adventure Fun Family Game for Kids and Adults | Ages 6+ | 2-4 Players | Average Playtime 15-30 Minutes | Made by Days of Wonder
Vendor:AmazonRegular price $21.99Regular priceUnit price / perSale price $21.99 -
...
Hedbanz 2023 Edition Cards Picture Guessing Board Game- Family Games | Games for Family Game Night| Kids Games | Card Games for Families & Kids Ages 6 and up
Vendor:AmazonRegular price $8.50Regular priceUnit price / perSale price $8.50 -
...
Winning Moves RACK-O, Retro package Card Game
Vendor:AmazonRegular price $8.79Regular priceUnit price / perSale price $8.79















