Collection: uoqowuerwehgflasfhdgfkasjyuwerwyeqrthgasdhkfcashwe-qwerqwedfjjlhh
-
...
Macy's Polo Ralph LaurenGirls' 7-16 Long-Sleeve Plaid Shirt Dress
Vendor:Macy'sRegular price $33.93Regular priceUnit price / perSale price $33.93 -
...
Macy's Polo Ralph LaurenGirls' 7-16 Striped Skirt Fleece Long-Sleeve Dress
Vendor:Macy'sRegular price $89.50Regular priceUnit price / perSale price $89.50 -
...
Macy's Polo Ralph LaurenGirls 7-16 Polo Bear Cotton Jersey Dress
Vendor:Macy'sRegular price $35.70Regular priceUnit price / perSale price $35.70 -
...
Grayson mini toddler
Vendor:TargetRegular price $13.60Regular priceUnit price / perSale price $13.60 -
...
DKNY Logo Sweatshirt
Vendor:Saks Off 5thRegular price $22.74Regular priceUnit price / perSale price $22.74 -
...
DKNY Logo Sweatshirt
Vendor:Saks Off 5thRegular price $22.74Regular priceUnit price / perSale price $22.74 -
...
CHASER Daisy Sweatshirt
Vendor:TJ MaxxRegular price $29.99Regular priceUnit price / perSale price $29.99 -
...
Scotch & Soda Logo Graphic Crewneck Sweatshirt
Vendor:Nordstrom RackRegular price $37.47Regular priceUnit price / perSale price $37.47 -
...
H & M Sweatshirt with Printed Motif
Vendor:H & MRegular price $19.99Regular priceUnit price / perSale price $19.99 -
...
Anthropologie Scotch & Soda Relaxed Sweatshirt
Vendor:AnthropologieRegular price $59.95Regular priceUnit price / perSale price $59.95 -
...
Amazon Amazon Basics Glazed Stoneware Dinnerware, Ceramic 12-Piece Set, 4 Full Place Settings, Dishwasher-Safe, Ivory
Vendor:AmazonRegular price $43.99Regular priceUnit price / perSale price $43.99 -
...
Amazon Melissa & Doug Self-Correcting Alphabet Puzzle (52 pcs) with Toy Storage Box, Wooden ABC Puzzles for Toddlers & Preschoolers, Montessori Learning Toys for Girls & Boys 4+
Vendor:AmazonRegular price $9.39Regular priceUnit price / perSale price $9.39 -
...
Anthropologie Silent D Heavens Mary Jane Flats
Vendor:AnthropologieRegular price $130.00Regular priceUnit price / perSale price $130.00 -
...
Celina Moon Alicia Long Sleeve Midi Shirtdress
Vendor:Nordstrom RackRegular price $99.97Regular priceUnit price / perSale price $99.97 -
...
CIEBON Faye Embroidered Tie Waist Long Sleeve Maxi Dress
Vendor:Nordstrom RackRegular price $63.97Regular priceUnit price / perSale price $63.97 -
...
Anthropologie Dolan Left Coast Mock-Neck Lace Blouse
Vendor:AnthropologieRegular price $69.95Regular priceUnit price / perSale price $69.95














