Collection: uoqowuerwehgflasfhdgfkasjyuwerwyeqrthgasdhkfcashwe-qwerqwedfjjlhh
-
...
EVEREADY LED Flashlights (4-Pack), Bright Flashlights for Emergencies and Camping Gear, Flash Light with AA Batteries Included, Blue/Yellow (4-Pack)
Vendor:AmazonRegular price $6.46Regular priceUnit price / per -
...
TINECO iFLOOR 2, Cordless, Wet/Dry Vacuum Cleaner, Blue
Vendor:WalmartRegular price $50.00Regular priceUnit price / per -
...
Shark Matrix Plus 2in1 Robot Vacuum & Mop with Sonic Mopping, Matrix Clean, Home Mapping, HEPA Bagless Self Empty Base, CleanEdge, for Pet Hair, WiFi, Black/Brass, AV2620WA
Vendor:AmazonRegular price $349.99Regular priceUnit price / per -
...
UGG® Skyview Classic Waterproof Boot (Men)
Vendor:Nordstrom RackRegular price $99.99Regular priceUnit price / per -
...
Apple AirTag 4 Pack
Vendor:AmazonRegular price $69.99Regular priceUnit price / per -
...
Time and Tru Women's Velvet Pleated Midi Skirt, Sizes XS-XXXL
Vendor:WalmartRegular price $19.98Regular priceUnit price / per -
...
UGG® Hillmont Chelsea Boot (Men)
Vendor:Nordstrom RackRegular price $129.97Regular priceUnit price / per -
...
Stuart Weitzman Size 9.5 Stuart 100 Ankle Bootie (Women)
Vendor:Nordstrom RackRegular price $140.38Regular priceUnit price / per -
...
SwissGear Travel Tech Elite, Black Dot, Large
Vendor:AmazonRegular price $49.99Regular priceUnit price / per -
...
Ziploc XL Sandwich and Snack Bags with EasyGuide Texture, Plastic Storage Bags with Grip 'n Seal Technology, 90 Bags Total
Vendor:AmazonRegular price $4.99Regular priceUnit price / per -
...
CRAFTSMAN CMXEVBE17590 9 Gallon 4.25 Peak HP Wet Dry Vac, Portable Shop Vacuum Wet and Dry with Filter, Dust Bag, Hose and Attachments for Home, Garage and Automotive Cleaning
Vendor:AmazonRegular price $49.99Regular priceUnit price / per -
...
Rubik's Pack & Go, 3 Game Bundle Race Flip Capture 2-Player Sequence Board Games 3D Puzzle Travel Game Gift Set, for Adults & Kids Ages 7+ Amazon Exclusive
Vendor:AmazonRegular price $9.99Regular priceUnit price / per -
...
Clip coupon Gator Golf - Putt The Ball into The Gator's Mouth to Score Game by Goliath, Single, Gator Golf, 27 x 27 x 12.5 cm for age 3+ years
Vendor:AmazonRegular price $6.66Regular priceUnit price / per -
...
Glad Tall Kitchen Drawstring Trash Bags - Odorshield 13 Gallon White Trash Bag, Febreze Fresh Clean, 110 Count
Vendor:AmazonRegular price $15.19Regular priceUnit price / per -
...
LG gram 2in1 16-Inch Lightweight Laptop 13th Gen Intel Core Processor i7-1360P Windows 11 Home 32GB RAM 1TB SSD - Black
Vendor:AmazonRegular price $999.99Regular priceUnit price / per -
...
Shyft DualRide with Carryall Storage Infant Car Seat and Stroller Combo (Durham Green)
Vendor:AmazonRegular price $290.15Regular priceUnit price / per